Comparing aligned amino acids to codon

To set the ball rolling, I tried to implement it manually with your files. Overall, there are three steps:

1. Locate NITNLC (or HAPATV) in protein P0DTC2.
2. Locate mismatched amino acids between proteins P0DTC2 and K9N5Q8 within the range from step 1.
3. Print the amino acid and the DNA codon of both proteins from step 2.

It works, but only for the first 60 amino acids. I wonder if it's due to the amino sequences in AMINOOO_seq_removed.fasta repeat itself every 60 acids. But why?

#For example, the first three lines of protein P0DTC2
>P0DTC2
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS
NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV
NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE
...

Step 0: Read the files.

library('seqinr')

#align file containing protein sequences
count_added <- read.alignment('count_added_.clustal_num', format='clustal')
names(count_added$seq) <- count_added$nam

#DNA sequences
rev3.aln <- read.alignment('rev3.aln', format='fasta')
names(rev3.aln$seq) <- rev3.aln$nam

Step 1: Locate NITNLC (or HAPATV) in protein P0DTC2. Again, there are two repeats of NITNLC 60 acids apart (at 807 and 870).

locate <- function(seq, find)
  {address <- gregexpr(paste(strsplit(find, '')[[1]], collapse='[^a-z]*'), seq)
  #substr(seq, address[[1]][1], address[[1]][1]+attr(address[[1]], 'match.length')[1]-1)

  return(list(start=as.numeric(address[[1]]), 
             end=as.numeric(address[[1]] + attr(address[[1]], 'match.length') - 1)))
  }

locate(seq=count_added$seq[['P0DTC2']], find='nitnlc')
#start
#807 870
#end
#812 875
locate(seq=count_added$seq[['P0DTC2']], find='hapatv')
#start
#1212 1279
#end
#1217 1285

Step 2: Locate mismatched amino acids between proteins P0DTC2 and K9N5Q8 within the range from step 1. Instead of using the range 812 - 1279, I chose range 1 - 20 for demonstration purposes.

compare <- function(seq1, seq2, after=0, before=100000)
  {seq1_ = strsplit(seq1, '')[[1]]
  seq2_ = strsplit(seq2, '')[[1]]
  ind = which(seq1_ != seq2_ & grepl('[a-z]',seq1_) & grepl('[a-z]',seq2_))
  ind = ind[ind>after & ind<before]
  #seq1_[ind[1]]
  #seq2_[ind[1]]

  return(ind)
  }
compare(seq1=count_added$seq[['P0DTC2']], seq2=count_added$seq[['K9N5Q8']], after=1, before=20)
# [1] 5  7  8  9 10 13 14

#protein comparison
#K9N5Q8      MIHSVFLLMFLLTPTESYVD
#P0DTC2      ----MFVFLVLLPL------
#<mismatch>      5 7890  34

Step 3: Print the amino acid and the DNA codon of both proteins from step 2. Note that ind is based on the align file.

print_amino_codon <- function(ind, seq, seq_gene)
  {locate_amino <- gregexpr('[a-z]', seq)[[1]]
  if (!ind %in% locate_amino) return(NA)
  ind2 = match(ind, locate_amino)

  return(c(amino=substr(seq, ind, ind), codon=substr(seq_gene, ind2*3-2, ind2*3)))
  }
 
codon(ind=5, seq=count_added$seq[['K9N5Q8']], seq_gene=rev3.aln$seq[['K9N5Q8']])
#amino codon 
#  "v" "atg" 
codon(ind=6, vseq=count_added$seq[['K9N5Q8']], seq_gene=rev3.aln$seq[['K9N5Q8']])
#amino codon 
#  "f" "ttc" 
codon(ind=7, seq=count_added$seq[['K9N5Q8']], seq_gene=rev3.aln$seq[['K9N5Q8']])
#amino codon 
#  "l" "ttg"

codon(ind=5, seq=count_added$seq[['P0DTC2']], seq_gene=rev3.aln$seq[['P0DTC2']])
#amino codon 
#  "m" "atg" 
codon(ind=6, seq=count_added$seq[['P0DTC2']], seq_gene=rev3.aln$seq[['P0DTC2']])
#amino codon 
#  "f" "ttt" 
codon(ind=7, seq=count_added$seq[['P0DTC2']], seq_gene=rev3.aln$seq[['P0DTC2']])
#amino codon 
#  "v" "gtt" 

#protein comparison
#K9N5Q8      MIHSVFLLMFLLTPTESYVD
#P0DTC2      ----MFVFLVLLPL------
#<mismatch>      5 7890  34
#<print>         ^^^

#K9N5Q8 gene codon
#gtg ttt cta ctg atg ttc ttg tta aca
#                ^^^ ^^^ ^^^
#P0DTC2 gene codon
#atg ttt gtt ttt ctt
#^^^ ^^^ ^^^